Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00285848-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00285848-B01P, RRID:AB_10773923
- Product name
- PNPLA1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human PNPLA1 protein.
- Antigen sequence
MVQMMRQFLYRVLPEDSYKVTTGKLHVSLTRLTDG
ENVVVSEFTSKEELIEALYCSCFVPVYCGLIPPTY
RGVWAFLTLPPQRYIDGGFTGMQPCAFWTDAITIS
TFSGQQDICPRDCPAIFHDFRMFNCSFQFSLENIA
RMTHALFPPDLVILHDYYYRGYEDAVLYLRRLNAV
YLNSSSKRVIFPRVEVYCQIELALGNECPERSQPS
LRARQASLEGATQPHKEWVPKGDGRGSHGPPVSQP
VQTLEFTCESPVSAPVSPLEQPPAQPLASSTPLSL
SGMPPVSFPAVHKPPSSTPGSSLPTPPPGLSPLSP
QQQVQPSGSPARSLHSQAPTSHRPSLGPSTVGAPQ
TLPRSSLSAFPAQPPVEELGQEQPQAVALLVSSKP
KSAVPLVHVKETVSKPYVMESPAEDSNWVNKVFKK
NKQKTSGTRKGFPRHPGSKKPSSKVQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PNPLA1 mutations cause autosomal recessive congenital ichthyosis in golden retriever dogs and humans.
Grall A, Guaguère E, Planchais S, Grond S, Bourrat E, Hausser I, Hitte C, Le Gallo M, Derbois C, Kim GJ, Lagoutte L, Degorce-Rubiales F, Radner FP, Thomas A, Küry S, Bensignor E, Fontaine J, Pin D, Zimmermann R, Zechner R, Lathrop M, Galibert F, André C, Fischer J
Nature genetics 2012 Jan 15;44(2):140-7
Nature genetics 2012 Jan 15;44(2):140-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PNPLA1 expression in transfected 293T cell line (H00285848-T01) by PNPLA1 MaxPab polyclonal antibody.Lane 1: PNPLA1 transfected lysate(49.06 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PNPLA1 MaxPab polyclonal antibody. Western Blot analysis of PNPLA1 expression in human placenta.